PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 617aa    MW: 67971.8 Da    PI: 6.8814
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16365.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-094134501954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  KHN16365.1 413 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 450
                 554459******************************88 PP

2BELL101.75.6e-33286352672
        BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +kk++Ll++l+eV++rY+qy++q+++v+ sFe v gl +a+pY+slA ka+S+hFrcLk+ai++q+
  KHN16365.1 286 GRKKSRLLTMLDEVYRRYRQYYQQMHAVVTSFEYVSGLSNAAPYASLAIKAMSKHFRCLKNAITDQL 352
                 68**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-44224350IPR006563POX domain
PfamPF075267.9E-37229349IPR006563POX domain
PROSITE profilePS5007112.098391454IPR001356Homeobox domain
SMARTSM003893.4E-10394458IPR001356Homeobox domain
CDDcd000864.04E-13394455No hitNo description
SuperFamilySSF466895.13E-17396460IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27397458IPR009057Homeodomain-like
PfamPF059201.1E-18411450IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MAEGFEAYHV PQQSRRDKLR VVATQNQQHG LIEPSSTLLP LYDPSSFISS DLLLTSFHNG  60
QKHNLGGCGV KEEQRANLMM GFAAAGGGVV MNNGSSSSSC CSSNSSSVSY LDPESSLHLN  120
QATIQVINNN NSNNMFLYQA QNLREFDQGY NNNNNNDDDN NNSEIMVFKP EPLSLSLSSH  180
NNGVNLQRYG SVVYGDKVGG GGVIYGSSGL NEVSRCTVPM GPFTGYASIL KGSRFLKPAQ  240
QLLEELCDVG GVCAEKIVAD ASLMEPIPPP QSSSEDPLGD HGGDQGRKKS RLLTMLDEVY  300
RRYRQYYQQM HAVVTSFEYV SGLSNAAPYA SLAIKAMSKH FRCLKNAITD QLQFANKAHF  360
HISNNRKDES PWFGNSDKGP YGQRPGFLEH QPVWRPQRGL PERAVTVLRA WLFEHFLHPY  420
PTDTDKLMLA KQTGLSRSQV SNWFINARVR LWKPMVEEIH LLETRQAPKN PQKEEHCRNK  480
LSDHLSSDNS IVSENPSTST DKFQEAPYKH TINELPNVPI RTQEQLNLPC TSNQPGGGGV  540
GVSMGGGSAS NSVSLTLGLY QNHGIGLAEP FPLNAAQRFG VALDTNNEGY VMSGYESQNR  600
HFGRDVIGGQ LLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-16400458563Homeobox protein Meis2
4xrm_B2e-16400458563Homeobox protein Meis2
4xrs_A2e-16400457158Homeobox protein Meis1
4xrs_B2e-16400457158Homeobox protein Meis1
5bng_A2e-16400458159Homeobox protein Meis2
5bng_B2e-16400458159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0953250.0BT095325.1 Soybean clone JCVI-FLGm-19C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629099.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0B2Q5260.0A0A0B2Q526_GLYSO; BEL1-like homeodomain protein 9
TrEMBLA0A0R0KMH20.0A0A0R0KMH2_SOYBN; Uncharacterized protein
STRINGGLYMA01G25710.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-96TALE family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]